PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_015292-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 336aa    MW: 35925.5 Da    PI: 7.3421
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_015292-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.44.5e-202368147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+++G+++W++I++ ++ gR++k+c++rw + 
  AHYPO_015292-RA 23 KGPWSPEEDEALTRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 68
                     79******************************.***********985 PP

2Myb_DNA-binding52.98.6e-1777119347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T++Ed+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  AHYPO_015292-RA  77 AFTPDEDDTIIKAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 119
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.9971873IPR017930Myb domain
SuperFamilySSF466892.94E-3220116IPR009057Homeodomain-like
SMARTSM007174.7E-182271IPR001005SANT/Myb domain
PfamPF002491.9E-192368IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-262476IPR009057Homeodomain-like
CDDcd001673.75E-172567No hitNo description
SMARTSM007179.5E-1474122IPR001005SANT/Myb domain
PROSITE profilePS5129420.4675124IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2277123IPR009057Homeodomain-like
CDDcd001675.30E-1177120No hitNo description
PfamPF002493.5E-1477119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MFNTCSSSST STKMNRKEVD RIKGPWSPEE DEALTRLVQK HGPRNWSLIS KSIPGRSGKS  60
CRLRWCNQLS PQVEHRAFTP DEDDTIIKAH ARFGNKWATI ARLLSGRTDN AIKNHWNSTL  120
KRKCSAMVCP APDDFSGDFP QPPPLKRAMS DGTDVILKNV SGLSLNNNNT NNPGSPGSSD  180
ASDSGSYIFR PVAVPGPVNI VPAPSFPPMT DLSLSLPGSD SCEVANSDPE PMTMPMVGSE  240
IQAFPTNSSA DTSPVTVMGT QTAVAPPTGA FSPEFLAVMQ DMIRKEVRTY MEGLEVSNNG  300
IGLGYGGFNN GGFCAQAADG VMRAAMSRIG IGKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-43221233104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679545.11e-142PREDICTED: transcription factor MYB44
SwissprotQ9FDW16e-80MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0K9R0E41e-161A0A0K9R0E4_SPIOL; Uncharacterized protein
STRINGVIT_07s0129g01050.t011e-113(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-82myb domain protein 73